A0A0U1RRL7 MMPOS_HUMAN

Gene name: MMP24OS
Protein name: Protein MMP24OS

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P02810 PRH1; 0.8028
2 A0A1B0GVQ3 CCDC200 0.78932
3 P17600 SYN1 0.78472 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
4 O60885 BRD4 0.77855 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cell cycle GO:0007049
...
5 Q15329 E2F5 0.77339 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
6 Q99218 AMELY 0.77046 anatomical structure development GO:0048856
7 Q86XK2 FBXO11 0.7574 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
...
8 P04280 PRB1 0.75449
9 Q9H9L7 AKIRIN1 0.74544 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
10 P78424 POU6F2 0.74172 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...

                                           20                  40                  60         
AA:                      MGAQLSGGRGAPEPAQTQPQPQPQPAAPEGPEQPRHPPQPQPQPQPQPQPEPSPWGPLDDVRFLIACTSWY
STMI:                                                                                           
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D.....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........
RICH_[PQ]:                  QlsggrgaPePaQtQPQPQPQPaaPegPeQPrhPPQPQPQPQPQPQPeP                   
RICH_[AP]:                         APePAqtqPqPqPqPAAP                                           
RICH_[AQ]:                         ApepAQtQpQpQpQpAA                                            
RICH_[P]:                           PePaqtqPqPqPqPaaPegPeqPrhPPqPqPqPqPqPqPeP                   
RICH_[Q]:                   QlsggrgapepaQtQpQpQpQpaapegpeQprhppQpQpQpQpQpQ                      
RICH_[GP]:                GaqlsGGrGaPePaqtqPqP                                                  
RICH_[GQ]:                GaQlsGGrGapepaQtQpQ                                                   
RICH_fLPS_[P]:                             PqPqPqPaaPegPeqPrhPPqPqPqPqPqPqPeP                   
RICH_fLPS_[Q]:                         aQtQpQpQpQpaapegpeQprhppQpQpQpQpQpQ                      
RICH_fLPS_[PQ]:                     PePaQtQPQPQPQPaaPegPeQPrhPPQPQPQPQPQPQPeP                   
RICH_MOBI_[PQ]:                     PePaQtQPQPQPQPaaPegPeQPrhPPQPQPQPQPQPQPePsPwgP              
RICH_MOBI_[AP]:                    APePAqtqPqPqPqPAAP                                           
RICH_MOBI_[AQ]:                    ApepAQtQpQpQpQpAA                                            
RICH_MOBI_[P]:                      PePaqtqPqPqPqPaaPegPeqPrhPPqPqPqPqPqPqPePsPwgP              
RICH_MOBI_[Q]:              QlsggrgapepaQtQpQpQpQpaapegpeQprhppQpQpQpQpQpQ                      
RICH_MOBI_[GQ]:           GaQlsGGrGapepaQtQpQ                                                   
RICH_fLPS_MOBI_[P]:                        PqPqPqPaaPegPeqPrhPPqPqPqPqPqPqPePsPwgP              
RICH_fLPS_MOBI_[Q]:                    aQtQpQpQpQpaapegpeQprhppQpQpQpQpQpQ                      
RICH_fLPS_MOBI_[PQ]:                PePaQtQPQPQPQPaaPegPeQPrhPPQPQPQPQPQPQPePsP                 
RICH_fLPS_MOBI_[QP]:                    QtQPQPQPQPaaPegPeQPrhPPQPQPQPQPQPQPePsP