A0A0U1RRN3 SPTOS_HUMAN
Gene name: SPTY2D1OS
Protein name: Putative transmembrane protein SPTY2D1OS
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MIVLGWMFFVGLVCYMGTFPELMPPTLKWQERWPVQESKTQLRRRALGEDLLQNHVEGI STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ........................................................... DO_IUPRED2A: ........................................................... DO_SPOTD: .....................................................DDDDDD CONSENSUS: . ..................................... CONSENSUS_MOBI: . .....................................