A0A1B0GUV8 A0A1B0GUV8_HUMAN
Gene name: LOC102723971
Protein name: Lipocln_cytosolic_FA-bd_dom domain-containing protein
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NH81 | OR10G6 | 0.99973 | |
| 2 | P20813 | CYP2B6 | 0.99673 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 3 | Q9H6B9 | EPHX3 | 0.99673 | small molecule metabolic process GO:0044281 |
| 4 | Q8NGR2 | OR1L6 | 0.99388 | signal transduction GO:0007165 |
| 5 | Q9Y2P5 | SLC27A5 | 0.98837 | biosynthetic process GO:0009058 generation of precursor metabolites and energy GO:0006091 small molecule metabolic process GO:0044281 ... |
| 6 | P50391 | NPY4R | 0.95506 | signal transduction GO:0007165 |
| 7 | O14638 | ENPP3 | 0.89415 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 8 | P05093 | CYP17A1 | 0.88158 | biosynthetic process GO:0009058 reproduction GO:0000003 small molecule metabolic process GO:0044281 |
| 9 | P33260 | CYP2C18 | 0.85896 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 10 | P24903 | CYP2F1 | 0.83906 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MALEKGPLLLLALGLGLAGAQKALEEVPVQPGFNAQKVEGRWLTLQLAANHADLVSPADPLRLALHSIRTRDGGDVDFVLFWKGEGVCKETNITVHPTQL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[L]: LekgpLLLLaLgLgL RICH_fLPS_[L]: LekgpLLLLaLgLgL
120 140 160 180 AA: QGQYQGSFEGGSMHVCFVSTDYSNLILYVRFEDDEITNLWVLLARRMLEDPKWLGRYLEYVEKFHLQKAPVFNIDGPCPPP STMI: DO_DISOPRED3: ................................................................................D DO_IUPRED2A: ................................................................................. DO_SPOTD: ............................................................................D.DDD CONSENSUS: ................................................................................D CONSENSUS_MOBI: .................................................................................