A0A1B0GUW7 SIM27_HUMAN
Gene name: SMIM27
Protein name: Small integral membrane protein 27
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MKPVSRRTLDWIYSVLLLAIVLISWGCIIYASMVSARRQLRKKYPDKIFGTNENL STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DD...................................................DD DO_IUPRED2A: ....................................................... DO_SPOTD: DDD............................................DDDDDDDD CONSENSUS: DD........ ......................DD CONSENSUS_MOBI: .......... ........................