A6NC05 YD286_HUMAN
Gene name: C5orf63
Protein name: Glutaredoxin-like protein C5orf63
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6NI87 | CBY3 | 0.80871 | |
| 2 | Q99959 | PKP2 | 0.7597 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 3 | Q8TB22 | SPATA20 | 0.70394 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 4 | P21754 | ZP3 | 0.69718 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q13515 | BFSP2 | 0.69526 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cytoskeleton organization GO:0007010 ... |
| 6 | A8MUN3 | n/a | 0.67911 | |
| 7 | Q6IQ20 | NAPEPLD | 0.6654 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 8 | Q68DN1 | C2orf16 | 0.65888 | |
| 9 | Q13247 | SRSF6 | 0.65513 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 10 | Q8WXF0 | SRSF12 | 0.64837 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
20 40 60 80 100 AA: MLWFQGNSMQLARSSFGLFLRNCSASKTTLPVLTLFTKDPCPLCDEAKEVLKPYENRQPYKDQKLPGTRRRRSPSSPSHPHMASQSGKRYNLTLNQVLSF STMI: DO_DISOPRED3: D..DDD.............................................................................................. DO_IUPRED2A: .......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............. DO_SPOTD: DDDD.............................................................DDDDDDDDDDDDDD..................... CONSENSUS: DDDD.............................................................DDDDDDDDDDDDDD..................... CONSENSUS_MOBI: ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............ RICH_[RS]: RRRRSpSSpS RICH_MOBI_[RS]: RRRRSpSSpShphmaSqS RICH_MOBI_[R]: RqpykdqklpgtRRRR RICH_MOBI_[S]: SpSSpShphmaSqS RICH_MOBI_[HS]: SpSSpSHpHmaSqS
120 AA: DYDMGLDAPKTISSDCGAFYCLRMFKSPDMTCCFYPKQ STMI: DO_DISOPRED3: ...................................... DO_IUPRED2A: ...................................... DO_SPOTD: ...................................... CONSENSUS: ...................................... CONSENSUS_MOBI: ......................................