A6NEH8 ZNAS2_HUMAN

Gene name: ZNF503-AS2
Protein name: Putative uncharacterized protein encoded by ZNF503-AS2

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q2M2I3 FAM83E 0.61476 signal transduction GO:0007165
2 Q9Y2W3 SLC45A1 0.60507 transmembrane transport GO:0055085
transport GO:0006810
3 P22681 CBL 0.60401 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
...
4 Q9UKN7 MYO15A 0.59098 anatomical structure development GO:0048856
cytoskeleton organization GO:0007010
cytoskeleton-dependent intracellular transport GO:0030705
...
5 P48023 FASLG 0.58099 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 A6NJU9 NPIPB13 0.57987
7 Q6UY14 ADAMTSL4 0.5786 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
8 Q3B8N2 LGALS9B 0.57845 cell adhesion GO:0007155
cell population proliferation GO:0008283
immune system process GO:0002376
9 Q02779 MAP3K10 0.575 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
10 Q8IWB4 SPATA31A7 0.57219 cell differentiation GO:0030154
reproduction GO:0000003

                                           20                  40                  60                  80                 100
AA:                      MGVWGKKHLRLTHAPSPTFSHLPPSPQAGEPGIDGISLAVVCAAFIRIHPARRHPARNGSRLACTPTPRPNAGLEVVSSARVAASLPSEGGWTSGAPRSS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDD....................................................................................
DO_IUPRED2A:             ......DD.....DDDDDDDDDDDDDDDDDD.D...................D..DDDDDDDDDDDDDDDDDDDDDDDDDD...D.DDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .....................................................................................DDDDDDDDDDDDDDD
RICH_[PR]:                                                                   RhPaRngsRlactPtPRP                              
RICH_[H]:                       HlrltHapsptfsH                                                                               
RICH_[P]:                              PsPtfshlPPsPqageP                                                                     
RICH_[R]:                                                                    RhpaRngsRlactptpR                               
RICH_[S]:                                                                                                    SlpSeggwtSgaprSS
RICH_[GS]:                                                                                                   SlpSeGGwtSGaprSS
RICH_[HP]:                           HaPsPtfsHlPPsP                                                                          
RICH_MOBI_[P]:                                                                                                           Prss
RICH_MOBI_[W]:                                                                                                      Wtsgaprss
RICH_MOBI_[GS]:                                                                                                 SeGGwtSGaprSS
RICH_MOBI_[GW]:                                                                                                   GGWtsGaprss

                                          120                 140                 160                 180     
AA:                      GLSLPGSAWQPPPLPVLRKPAWPGSPAVKNESKFPNRGSRNFPRRRLPPAPVSGEPPERCKLAREIRWRLWKAHEGWGGGAKRPLGDPAWSGVKR
STMI:                                                                                                                   
DO_DISOPRED3:            ....................................................................................DDDDDD.DDDD
DO_IUPRED2A:             DDDDDDDDDDD.DDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDD.DDD................DDDDDDDDDDDDDDDDD.DDDD.DDDD.DD.......................DDDDDDDDDDDD.DDDDD
CONSENSUS:               DDDDDDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................DDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................
RICH_[PR]:                                                 PnRgsRnfPRRRlPPaP                                            
RICH_[G]:                                                                                             GGGakrplGdpawsG   
RICH_[R]:                                                    RgsRnfpRRR                                                 
RICH_[S]:                glS                                                                                            
RICH_[FN]:                                            NeskFpNrgsrNF                                                     
RICH_[FR]:                                                FpnRgsRnFpRRR                                                 
RICH_[GS]:               GlS                                                                                            
RICH_[NR]:                                                  NRgsRNfpRR                                                  
RICH_fLPS_[R]:                                               RgsRnfpRRR                                                 
RICH_MOBI_[PR]:                                                 RnfPRRRlPPaPvsgePP                                      
RICH_MOBI_[PW]:              PgsaWqPPPlPvlrkPaWPgsP                                                                     
RICH_MOBI_[L]:            LsLpgsawqpppLpvL                                                                              
RICH_MOBI_[N]:                                        NeskfpNrgsrN                                                      
RICH_MOBI_[P]:           glslPgsawqPPPlPvlrkPawPgsP                PrrrlPPaPvsgePP                                      
RICH_MOBI_[R]:                                               RgsRnfpRRR                                                 
RICH_MOBI_[W]:           glslpgsaWqppplpvlrkpaW                                                                         
RICH_MOBI_[FN]:                                       NeskFpNrgsrNF                                                     
RICH_MOBI_[FR]:                                           FpnRgsRnFpRRR                                                 
RICH_MOBI_[GS]:          GlSlpGS                                                                                        
RICH_MOBI_[GW]:          GlslpGsaW                                                                                      
RICH_MOBI_[LP]:           LsLPgsawqPPPLPvLrkP                                                                           
RICH_MOBI_[NR]:                                             NRgsRNfpRR                                                  
RICH_fLPS_MOBI_[R]:                                          RgsRnfpRRR