A6NGS2 ERIC4_HUMAN

Gene name: ERICH4
Protein name: Glutamate-rich protein 4

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96MC2 DRC1 0.84265 anatomical structure development GO:0048856
cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
...
2 P46060 RANGAP1 0.82546 cellular protein modification process GO:0006464
nucleocytoplasmic transport GO:0006913
protein transport GO:0015031
...
3 Q9H321 VCX3B 0.81906 anatomical structure development GO:0048856
4 Q9GZS0 DNAI2 0.81877 anatomical structure development GO:0048856
cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
...
5 Q99645 EPYC 0.8116 anatomical structure development GO:0048856
nervous system process GO:0050877
reproduction GO:0000003
6 Q9HCU9 BRMS1 0.80566 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
7 Q969Q1 TRIM63 0.804 catabolic process GO:0009056
cellular protein modification process GO:0006464
signal transduction GO:0007165
8 A6NMX2 EIF4E1B 0.79815
9 Q9H4B7 TUBB1 0.79278 cell cycle GO:0007049
cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
...
10 P49642 PRIM1 0.78806 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MELWRQLNQAGLVPPGLGPPPQALREVSPVEIPGQTLRTAGADTGGACDSLLWIREELGNLRRVDVQLLGQLCSLGLEMGALREELVTILEEEEESSKEE
STMI:                                                                                                                        
DO_DISOPRED3:            .............................................................................................DDDDDDD
DO_IUPRED2A:             .........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................DDDDDDDDDDDDDDD
DO_SPOTD:                DD........................DDDDDDDDDD..DDDDDDD...................................DDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..........................DDDDDDDDDDDDDDDDD..........................................DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..........................................................................................DDDDDDDDDD
RICH_[E]:                                                                                                          EEEEEsskEE
RICH_[EQ]:                                                                                                                 EE
RICH_fLPS_[E]:                                                                                                     EEEEEsskEE
RICH_MOBI_[E]:                                                                                                     EEEEEsskEE
RICH_MOBI_[EQ]:                                                                                                            EE
RICH_fLPS_MOBI_[E]:                                                                                                EEEEEsskEE

                                          120          
AA:                      EEDQEPQRKQEEEHLEACPAPHPPDFEMMI
STMI:                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD.............
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[E]:                EEdqEpqrkqEEEhlE              
RICH_[EP]:                   EPqrkqEEEhlEacPaPhPPdfE   
RICH_[EQ]:               EEdQEpQrkQEEEhlE              
RICH_fLPS_[E]:           EEdqEpqrkqEEEhlE              
RICH_MOBI_[E]:           EEdqEpqrkqEEEhlE              
RICH_MOBI_[EM]:                    EEEhlEacpaphppdfEMM 
RICH_MOBI_[EQ]:          EEdQEpQrkQEEEhlE              
RICH_fLPS_MOBI_[E]:      EEdqEpqrkqEEEhlE