A6NM66 CU054_HUMAN
Gene name: LINC01548
Protein name: Uncharacterized protein encoded by LINC01548
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A0PJX4 | SHISA3 | 0.82595 | anatomical structure development GO:0048856 |
| 2 | P15529 | CD46 | 0.78668 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 3 | Q14119 | VEZF1 | 0.76896 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 4 | Q8WV99 | ZFAND2B | 0.76298 | catabolic process GO:0009056 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 5 | Q9BT88 | SYT11 | 0.76086 | catabolic process GO:0009056 cell-cell signaling GO:0007267 cellular component assembly GO:0022607 ... |
| 6 | P08912 | CHRM5 | 0.73496 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 7 | Q99259 | GAD1 | 0.72392 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell-cell signaling GO:0007267 ... |
| 8 | Q96N23 | CFAP54 | 0.71414 | cell differentiation GO:0030154 cellular component assembly GO:0022607 reproduction GO:0000003 |
| 9 | Q9BZF2 | OSBPL7 | 0.70947 | biosynthetic process GO:0009058 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 10 | O43318 | MAP3K7 | 0.69624 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MLAKGAEEGRSGGPRPAITLPGSLHFTCDLKTSPYCLTRAELMEHLPLRVAVHSMSPCHRSCFCGELKRGHPWNTPQVSSFPSSTTSLSHSCTTSHLDCS STMI: DO_DISOPRED3: DDDDDDDDDDDDD....................................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDD.........................................................DDDDDDD................... DO_SPOTD: DDDDDDDDDDDDDDD........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDD...........................................................DDDDDDD................... CONSENSUS_MOBI: ..........................................................................DDDDDDDDDDDDDDDDDDDD...... RICH_MOBI_[S]: SSfpSSttSlShS RICH_MOBI_[T]: TpqvssfpssTTslshscTT RICH_MOBI_[ST]: TpqvSSfpSSTTSlShScTT
AA: QQVESGSK STMI: DO_DISOPRED3: .....DDD DO_IUPRED2A: ........ DO_SPOTD: DDDDDDDD CONSENSUS: .....DDD CONSENSUS_MOBI: ........