A6NMA1 TR5OS_HUMAN

Gene name: TRPC5OS
Protein name: Putative uncharacterized protein TRPC5OS

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96LK8 SPATA32 0.67016 reproduction GO:0000003
2 P28289 TMOD1 0.65732 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
3 Q9NS61 KCNIP2 0.65111 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
4 Q16790 CA9 0.63509 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
5 P0C0L4 C4A 0.61809 cellular protein modification process GO:0006464
immune system process GO:0002376
response to stress GO:0006950
...
6 Q3KNS1 PTCHD3 0.61536 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003
7 P25963 NFKBIA 0.60319 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
8 Q8TDY8 IGDCC4 0.59632
9 Q92797 SYMPK 0.59234 biosynthetic process GO:0009058
cell adhesion GO:0007155
cellular nitrogen compound metabolic process GO:0034641
...
10 Q32M45 ANO4 0.59094 membrane organization GO:0061024
plasma membrane organization GO:0007009
transmembrane transport GO:0055085
...

                                           20                  40                  60                  80                 100
AA:                      MDSVLIHVLIDGLVACVAQLIRIADELLQFILQVQEVPYVEENGRAEETEADAPLPEEPSLPDLPDLSDLDSILTPREDEDLIFDIDQAMLDMDNLYEDT
STMI:                                                                                                                        
DO_DISOPRED3:            DD..................................................................................................
DO_IUPRED2A:             ........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
DO_SPOTD:                DD................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDD...................DD
CONSENSUS:               DD......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
CONSENSUS_MOBI:          ..........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
RICH_[D]:                                                                   DaplpeepslpDlpDlsDlD                             
RICH_[E]:                                                        EEngraEEtEadaplpEE                                          
RICH_[L]:                                                                            LpdLpdLsdL                              
RICH_[DL]:                                                                  DapLpeepsLpDLpDLsDLD                             
RICH_[DP]:                                                                  DaPlPeePslPDlPDlsDlD                             
RICH_[EL]:                                                              EtEadapLpEEpsLpdLpdL                                 
RICH_[EP]:                                                             EEtEadaPlPEEPslPdlP                                   
RICH_[LP]:                                                                    PLPeePsLPdLPdLsdL                              
RICH_fLPS_[D]:                                                                        pDlpDlsDlD                             
RICH_fLPS_[E]:                                                   EEngraEEtEadaplpEEps                                        
RICH_MOBI_[D]:                                                              DaplpeepslpDlpDlsDlD                             
RICH_MOBI_[E]:                                                         EEtEadaplpEE                                          
RICH_MOBI_[L]:                                                                 LpeepsLpdLpdLsdL                              
RICH_MOBI_[DL]:                                                             DapLpeepsLpDLpDLsDLD                             
RICH_MOBI_[DP]:                                                             DaPlPeePslPDlPD                                  
RICH_MOBI_[EL]:                                                         EtEadapLpEEpsLpdLpdL                                 
RICH_MOBI_[LP]:                                                               PLPeePsLPdLPdL                                 

                                  
AA:                      VSGINDDLTGD
STMI:                               
DO_DISOPRED3:            .........DD
DO_IUPRED2A:             .D.D..DDDD.
DO_SPOTD:                DDDDDDDDDDD
CONSENSUS:               .DDDDDDDDDD
CONSENSUS_MOBI:          ...........