A6NMA1 TR5OS_HUMAN
Gene name: TRPC5OS
Protein name: Putative uncharacterized protein TRPC5OS
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96LK8 | SPATA32 | 0.67016 | reproduction GO:0000003 |
| 2 | P28289 | TMOD1 | 0.65732 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 3 | Q9NS61 | KCNIP2 | 0.65111 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 4 | Q16790 | CA9 | 0.63509 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | P0C0L4 | C4A | 0.61809 | cellular protein modification process GO:0006464 immune system process GO:0002376 response to stress GO:0006950 ... |
| 6 | Q3KNS1 | PTCHD3 | 0.61536 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 7 | P25963 | NFKBIA | 0.60319 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 8 | Q8TDY8 | IGDCC4 | 0.59632 | |
| 9 | Q92797 | SYMPK | 0.59234 | biosynthetic process GO:0009058 cell adhesion GO:0007155 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q32M45 | ANO4 | 0.59094 | membrane organization GO:0061024 plasma membrane organization GO:0007009 transmembrane transport GO:0055085 ... |
20 40 60 80 100 AA: MDSVLIHVLIDGLVACVAQLIRIADELLQFILQVQEVPYVEENGRAEETEADAPLPEEPSLPDLPDLSDLDSILTPREDEDLIFDIDQAMLDMDNLYEDT STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: ........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................ DO_SPOTD: DD................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDD...................DD CONSENSUS: DD......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................ CONSENSUS_MOBI: ..........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................ RICH_[D]: DaplpeepslpDlpDlsDlD RICH_[E]: EEngraEEtEadaplpEE RICH_[L]: LpdLpdLsdL RICH_[DL]: DapLpeepsLpDLpDLsDLD RICH_[DP]: DaPlPeePslPDlPDlsDlD RICH_[EL]: EtEadapLpEEpsLpdLpdL RICH_[EP]: EEtEadaPlPEEPslPdlP RICH_[LP]: PLPeePsLPdLPdLsdL RICH_fLPS_[D]: pDlpDlsDlD RICH_fLPS_[E]: EEngraEEtEadaplpEEps RICH_MOBI_[D]: DaplpeepslpDlpDlsDlD RICH_MOBI_[E]: EEtEadaplpEE RICH_MOBI_[L]: LpeepsLpdLpdLsdL RICH_MOBI_[DL]: DapLpeepsLpDLpDLsDLD RICH_MOBI_[DP]: DaPlPeePslPDlPD RICH_MOBI_[EL]: EtEadapLpEEpsLpdLpdL RICH_MOBI_[LP]: PLPeePsLPdLPdL
AA: VSGINDDLTGD STMI: DO_DISOPRED3: .........DD DO_IUPRED2A: .D.D..DDDD. DO_SPOTD: DDDDDDDDDDD CONSENSUS: .DDDDDDDDDD CONSENSUS_MOBI: ...........