A6PVY3 F177B_HUMAN

Gene name: FAM177B
Protein name: Protein FAM177B

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q7LGC8 CHST3 0.92333 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
2 Q8WWZ4 ABCA10 0.90049 transport GO:0006810
3 P49642 PRIM1 0.89879 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
4 Q96PQ6 ZNF317 0.85829 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q8IU89 CERS3 0.85683 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
6 Q96MC2 DRC1 0.85542 anatomical structure development GO:0048856
cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
...
7 Q8NG66 NEK11 0.85458 cell cycle GO:0007049
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
8 Q7Z5L7 PODN 0.85266 cell population proliferation GO:0008283
9 P0DM63 NPIPA8 0.85236
10 Q969Q1 TRIM63 0.85184 catabolic process GO:0009056
cellular protein modification process GO:0006464
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MEIDGFQQLDLEKSVPSKKTTPKRIIHFVDGDIMEEYSTEEEEEEEKEEQSTNSTLDPSKLSWGPYLRFWAGRIASTSFSTCEFLGGRFAVFFGLTQPKY
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD.DDDDDD..........................DDDDDDDDDDDDDDD...............................................
DO_IUPRED2A:             .............D.....................DDDDDDDDDDDDDDDDDDDDD............................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDD..................DDDDDDDDDDDDDDDDDDD...........................................
CONSENSUS:               DDDDDDDDDDDDDD........................DDDDDDDDDDDDDDDDDD............................................
CONSENSUS_MOBI:          ...................................DDDDDDDDDDDDDDDDDDDDDDDD.........................................
RICH_[E]:                                                       EEEEEEEkEE                                                   
RICH_fLPS_[E]:                                                 tEEEEEEEkEEqstn                                               
RICH_MOBI_[E]:                                              EystEEEEEEEkEE                                                   
RICH_fLPS_MOBI_[E]:                                         EystEEEEEEEkEEqstnst                                             

                                          120                 140  
AA:                      QYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVQEYGTIQQDVTEAIPQ
STMI:                                                                              
DO_DISOPRED3:            ...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..............DDDDDDDDDDDDDDDDD.DD.....................D..
DO_SPOTD:                ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..........................................................
RICH_[AE]:                                        AqAAEvpnEkchlEAgvqE              
RICH_[Q]:                                                          QeygtiQQdvteaipQ
RICH_[IQ]:                                                         QeygtIQQdvteaIpQ