A8MQ03 CRTP1_HUMAN

Gene name: CYSRT1
Protein name: Cysteine-rich tail protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BYU1 PBX4 0.80698 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 P48549 KCNJ3 0.70338 cell-cell signaling GO:0007267
circulatory system process GO:0003013
transmembrane transport GO:0055085
...
3 Q96G25 MED8 0.67889 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
4 Q9BVH7 ST6GALNAC5 0.66111 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular nitrogen compound metabolic process GO:0034641
...
5 Q4U2R8 SLC22A6 0.6513 transport GO:0006810
6 P43699 NKX2-1 0.63668 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 Q9H853 TUBA4B 0.61394 cell cycle GO:0007049
cytoskeleton organization GO:0007010
mitotic cell cycle GO:0000278
8 Q8WTU0 DDI1 0.60897 catabolic process GO:0009056
9 Q9BWU1 CDK19 0.60867 cell death GO:0008219
cellular protein modification process GO:0006464
response to stress GO:0006950
10 Q8IYN6 UBALD2 0.59888

                                           20                  40                  60                  80                 100
AA:                      MDPQEMVVKNPYAHISIPRAHLRPDLGQQLEVASTCSSSSEMQPLPVGPCAPEPTHLLQPTEVPGPKGAKGNQGAAPIQNQQAWQQPGNPYSSSQRQAGL
STMI:                                                                                                                        
DO_DISOPRED3:            D.............................DDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDD.DDDDDDDDDDDDDD.DDD.........DD........
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDD..D....DD.......................D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDD..
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..
CONSENSUS_MOBI:          ..................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AG]:                                                                               GpkGAkGnqGAApiqnqqA                 
RICH_[AQ]:                                                                                   AkgnQgAApiQnQQAwQQ              
RICH_[G]:                                                                                GpkGakGnqG                          
RICH_[P]:                                                           PlPvgPcaPePthllqPtevPgP                                  
RICH_[Q]:                                                                                        QgaapiQnQQawQQpgnpysssQrQ   
RICH_[CP]:                                                  CssssemqPlPvgPCaPeP                                              
RICH_[GP]:                                                                          PtevPGPkGakGnqGaaP                       
RICH_[GQ]:                                                                               GpkGakGnQGaapiQnQQ                  
RICH_[NQ]:                                                                                      NQgaapiQNQ                   
RICH_fLPS_[Q]:                                                                                  nQgaapiQnQQawQQpgnpysssQrQ   
RICH_MOBI_[AG]:                                                                          GpkGAkGnqGAApiqnqqA                 
RICH_MOBI_[QY]:                                                                                              QQpgnpYsssQrQagl
RICH_MOBI_[AQ]:                                                                              AkgnQgAApiQnQQAwQQ              
RICH_MOBI_[G]:                                                                           GpkGakGnqG                          
RICH_MOBI_[Q]:                                                                                   QgaapiQnQQawQQpgnpysssQrQ   
RICH_MOBI_[Y]:                                                                                                     Ysssqrqagl
RICH_MOBI_[GQ]:                                                                          GpkGakGnQGaapiQnQQ                  
RICH_MOBI_[NQ]:                                                                                 NQgaapiQNQ                   
RICH_fLPS_MOBI_[Q]:                                                                              QgaapiQnQQawQQpgnpysssQrQ   

                                          120                 140                
AA:                      TYAGPPPAGRGDDIAHHCCCCPCCHCCHCPPFCRCHSCCCCVIS
STMI:                                                                
DO_DISOPRED3:            ............................................
DO_IUPRED2A:             DDDDDDD.....................................
DO_SPOTD:                ............................................
CONSENSUS:               ............................................
CONSENSUS_MOBI:          DDDDD.......................................
RICH_MOBI_[QY]:          tY                                          
RICH_MOBI_[Y]:           tY