C9JQL5 DSA2D_HUMAN
Protein name: Putative dispanin subfamily A member 2d
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P53708 | ITGA8 | 0.63117 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 2 | O43699 | SIGLEC6 | 0.50192 | cell adhesion GO:0007155 cell-cell signaling GO:0007267 |
| 3 | Q9HBW1 | LRRC4 | 0.4777 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 4 | Q9C0K1 | SLC39A8 | 0.45714 | biosynthetic process GO:0009058 cell adhesion GO:0007155 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q9GZX9 | TWSG1 | 0.45082 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 6 | Q96NW4 | ANKRD27 | 0.43328 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 7 | Q92633 | LPAR1 | 0.43237 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 8 | Q96TA2 | YME1L1 | 0.38991 | catabolic process GO:0009056 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 9 | P35410 | MAS1L | 0.3664 | signal transduction GO:0007165 |
| 10 | Q9UK28 | TMEM59L | 0.36585 |
20 40 60 80 100 AA: MNHTVQTFFSPVNSGQPPNYEMLKEEHKVAVLGVPHNPAPPTSTVIHIRSKTSVPHHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGNVTGAQAYA STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............... ...................... CONSENSUS_MOBI: ......................................................... ...................... RICH_[HV]: HkVaVlgVpH
120 AA: STTKCLNIWALILGILMTILLIIIPVLIFQAHR STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .......................DDDD.....D DO_IUPRED2A: ................................. DO_SPOTD: ............................DDDDD CONSENSUS: ....... ....D CONSENSUS_MOBI: ....... .....