C9JXX5 CK094_HUMAN

Gene name: C11orf94
Protein name: Uncharacterized protein C11orf94

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q3KQV9 UAP1L1 0.80669 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
2 Q9Y6Z4 KIF25-AS1 0.69058
3 Q96ID5 IGSF21 0.69058
4 Q96SQ5 ZNF587 0.66603 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 A1IGU5 ARHGEF37 0.66584
6 Q8TAU3 ZNF417 0.66471 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 P20800 EDN2 0.65078 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
8 Q9UK39 NOCT 0.64195 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
9 Q9Y3Z3 SAMHD1 0.63379 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
10 Q06546 GABPA 0.62495 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80  
AA:                      MVLAMLGALHPRAGLSLFLHLILAVALLRSQPLRSQRSVPEAFSAPLELSQPLSGLVDDYGILPKHPRPRGPRPLLSRAQQRKRDGPDLAEYYYDAHL
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                    
DO_DISOPRED3:            DD.........................................................................DDDDDD.................
DO_IUPRED2A:             ...............................................................D...D.DDDDDDDDDDDDD................
DO_SPOTD:                DDDDDDDDDDDD.................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........DDDD
CONSENSUS:                                             .................................DDDDD.DDDDDDDDDDDDD................
CONSENSUS_MOBI:                                        .............................DDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
RICH_MOBI_[PR]:                                                                         PkhPRPRgPRP                        
RICH_MOBI_[R]:                                                                              RpRgpRpllsRaqqRkR              
RICH_MOBI_[LP]:                                                                        LPkhPrPrgPrPLL