List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40             
AA:                      MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPSA
STMI:                          MMMMMMMMMMMMMMMMM                        
DO_DISOPRED3:            D..........................................DDDD
DO_IUPRED2A:             .........................................DD.DDD
DO_SPOTD:                DDDDD...............................DDDDDDDDDDD
CONSENSUS:               D.....                 ..................DDDDDD
CONSENSUS_MOBI:          ......                 ........................