F2Z3F1 CE067_HUMAN
Gene name: C5orf67
Protein name: Uncharacterized protein C5orf67
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96L92 | SNX27 | 0.85538 | immune system process GO:0002376 protein transport GO:0015031 signal transduction GO:0007165 ... |
| 2 | A8MV23 | SERPINE3 | 0.84448 | |
| 3 | Q9UIG8 | SLCO3A1 | 0.83182 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | P31276 | HOXC13 | 0.82947 | anatomical structure development GO:0048856 |
| 5 | Q6XUX3 | DSTYK | 0.8271 | cell death GO:0008219 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 6 | Q9UKL4 | GJD2 | 0.80505 | cell-cell signaling GO:0007267 nervous system process GO:0050877 |
| 7 | Q15477 | SKIV2L | 0.80397 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 nucleobase-containing compound catabolic process GO:0034655 |
| 8 | Q9NXD2 | MTMR10 | 0.79951 | |
| 9 | Q8IV45 | UNC5CL | 0.79885 | cellular protein modification process GO:0006464 response to stress GO:0006950 signal transduction GO:0007165 |
| 10 | Q8N7G0 | POU5F2 | 0.79057 | biosynthetic process GO:0009058 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MKRIFYKHRKRRAPVFKEPEHGYQSLPELVLVPAQPLVCLGDYRTPDPGGLFPWSLRLMMPGAWTKLPGDGGSVPEKGKHGILGAQGQEHPGLNVSSPFS STMI: DO_DISOPRED3: DD.D...D............................................................................................ DO_IUPRED2A: ................DDD...............................................DDDDDD.DDDDDDDDDDDDDDDDDDD.D...... DO_SPOTD: DDDDDDDDDDDDDDDDDD.D.................................................DDDDD.DDDD..................... CONSENSUS: DDDDDDDD........DD...................................................DDDDDDDDDD..................... CONSENSUS_MOBI: ....................................................................DDDDDDDDDDDDDDDDDDDDDDDDDD...... RICH_MOBI_[G]: GdGGsvpekGkhGilGaqG RICH_MOBI_[GH]: GkHGilGaqGqeHpG RICH_fLPS_MOBI_[G]: GdGGsvpekGkhGilGaqGq
120 AA: SPWTCYLSGHQPQNNNSPELQVKEILL STMI: DO_DISOPRED3: ........................... DO_IUPRED2A: .......DDDD..DDDDDDDDD..... DO_SPOTD: ............DDDDDDDDDDDDDDD CONSENSUS: .............DDDDDDDDD..... CONSENSUS_MOBI: ...........................