H3BU77 CC179_HUMAN

Gene name: CCDC179
Protein name: Coiled-coil domain-containing protein 179

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O00755 WNT7A 0.87336
2 A6NCN8 TEX52 0.81184
3 Q49A88 CCDC14 0.81175 anatomical structure development GO:0048856
4 Q9Y6T7 DGKB 0.79264 cell junction organization GO:0034330
cell-cell signaling GO:0007267
response to stress GO:0006950
...
5 A0A2R8Y7J0 CFAP97D2 0.79092
6 P55160 NCKAP1L 0.75941 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
7 Q8IYA8 IHO1 0.74836 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
8 Q8N0W7 FMR1NB 0.74072
9 Q14703 MBTPS1 0.73935 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
nucleocytoplasmic transport GO:0006913
...
10 Q8N609 TRAM1L1 0.7265 protein targeting GO:0006605
protein transport GO:0015031
transmembrane transport GO:0055085
...

                                           20                  40                  60            
AA:                      MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS
STMI:                                                                                        
DO_DISOPRED3:            ....................................................................
DO_IUPRED2A:             ............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....D...DDD..
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDD..D.....DDDDDDDDDDDDDDDDD.DD.............
CONSENSUS:               ............DDDDDDDDDDDDDDDDDD.....DDDDDDDDDDDDDDDDDDDD.............
CONSENSUS_MOBI:          ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[KR]:                                                         KKeKRRlnKRfsR             
RICH_MOBI_[K]:                                            KriqnmqhlKKeKrrlnK                 
RICH_MOBI_[R]:                                       RqlankRiqnmqhlkkekRR                    
RICH_MOBI_[KR]:                                      RqlanKRiqnmqhlKKeKRRlnKR