O00175 CCL24_HUMAN
Gene name: CCL24
Protein name: C-C motif chemokine 24
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P21854 | CD72 | 0.63596 | cell adhesion GO:0007155 |
| 2 | Q9UBK8 | MTRR | 0.58859 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q8N5I4 | DHRSX | 0.5235 | catabolic process GO:0009056 |
| 4 | Q9UHC9 | NPC1L1 | 0.52192 | biosynthetic process GO:0009058 response to stress GO:0006950 small molecule metabolic process GO:0044281 ... |
| 5 | P04275 | VWF | 0.50318 | cell adhesion GO:0007155 extracellular matrix organization GO:0030198 response to stress GO:0006950 ... |
| 6 | P30531 | SLC6A1 | 0.48379 | cell junction organization GO:0034330 cell-cell signaling GO:0007267 circulatory system process GO:0003013 ... |
| 7 | P52815 | MRPL12 | 0.46468 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 8 | Q8N7R7 | CCNYL1 | 0.43591 | cell cycle GO:0007049 cellular protein modification process GO:0006464 reproduction GO:0000003 |
| 9 | Q5T2Q4 | CCNYL2 | 0.42196 | cell cycle GO:0007049 cellular protein modification process GO:0006464 |
| 10 | O94952 | FBXO21 | 0.41403 | catabolic process GO:0009056 cellular protein modification process GO:0006464 |
20 40 60 80 100 AA: MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRA STMI: SSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD.....................................................................DDDDDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDD..................................................................DDDDDDDDD CONSENSUS: ....................................................................DDDDDD CONSENSUS_MOBI: .......................................................................... RICH_[AV]: A
AA: RAVAVKGPVQRYPGNQTTC STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ................... DO_SPOTD: DDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................... RICH_[AV]: rAVAVkgpV