O00422 SAP18_HUMAN
Gene name: SAP18
Protein name: Histone deacetylase complex subunit SAP18
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q8NF99 | ZNF397 | 0.94734 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
2 | Q14571 | ITPR2 | 0.93571 |
cell-cell signaling
GO:0007267 circulatory system process GO:0003013 homeostatic process GO:0042592 ... |
3 | Q6P474 | PDXDC2P | 0.89746 | |
4 | Q9NXN4 | GDAP2 | 0.86328 | |
5 | Q8NCY6 | MSANTD4 | 0.82484 | |
6 | Q8NHP6 | MOSPD2 | 0.79851 |
immune system process
GO:0002376 transport GO:0006810 vesicle-mediated transport GO:0016192 |
7 | Q96NJ6 | ZFP3 | 0.78089 | |
8 | P15509 | CSF2RA | 0.74204 | |
9 | P11836 | MS4A1 | 0.72294 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
10 | P54277 | PMS1 | 0.72119 |
cellular nitrogen compound metabolic process
GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
20 40 60 80 100
AA: MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPG
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDD.....................................................................................
DO_IUPRED2A: D...DDDDDDDDDDDDDDDDD..................DDDDDDDDD.D..................................................
DO_SPOTD: DDDDDDDDDDDDDDDDDDD.................................................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDD.................................................................................
CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDD................................................................................
RICH_[E]: EsrvtqEEikkEpE
RICH_MOBI_[E]: EsrvtqEEikkEpE
RICH_MOBI_[EI]: EsrvtqEEIkkEpEkpI
120 140
AA: YRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY
STMI:
DO_DISOPRED3: ..........................................DDDDDDDDDDD
DO_IUPRED2A: ...DDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDD
DO_SPOTD: ..........................................DDDDDDDDDDD
CONSENSUS: ..........................................DDDDDDDDDDD
CONSENSUS_MOBI: .....................................................