O00422 SAP18_HUMAN
Gene name: SAP18
Protein name: Histone deacetylase complex subunit SAP18
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NF99 | ZNF397 | 0.94734 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q14571 | ITPR2 | 0.93571 | cell-cell signaling GO:0007267 circulatory system process GO:0003013 homeostatic process GO:0042592 ... |
| 3 | Q6P474 | PDXDC2P | 0.89746 | |
| 4 | Q9NXN4 | GDAP2 | 0.86328 | |
| 5 | Q8NCY6 | MSANTD4 | 0.82484 | |
| 6 | Q8NHP6 | MOSPD2 | 0.79851 | immune system process GO:0002376 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 7 | Q96NJ6 | ZFP3 | 0.78089 | |
| 8 | P15509 | CSF2RA | 0.74204 | |
| 9 | P11836 | MS4A1 | 0.72294 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 10 | P54277 | PMS1 | 0.72119 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
20 40 60 80 100 AA: MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDD..................................................................................... DO_IUPRED2A: D...DDDDDDDDDDDDDDDDD..................DDDDDDDDD.D.................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDD................................................................................ RICH_[E]: EsrvtqEEikkEpE RICH_MOBI_[E]: EsrvtqEEikkEpE RICH_MOBI_[EI]: EsrvtqEEIkkEpEkpI
120 140 AA: YRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY STMI: DO_DISOPRED3: ..........................................DDDDDDDDDDD DO_IUPRED2A: ...DDDDDDDDDDDDDDDDDDD...............DDDDDDDDDDDDDDDD DO_SPOTD: ..........................................DDDDDDDDDDD CONSENSUS: ..........................................DDDDDDDDDDD CONSENSUS_MOBI: .....................................................