O00631 SARCO_HUMAN
Gene name: SLN
Protein name: Sarcolipin
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 AA: MGINTRELFLNFTIVLITVILMWLLVRSYQY STMI: MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: D.............................. DO_IUPRED2A: ............................... DO_SPOTD: DDDD................D.DDDDDDDDD CONSENSUS: D...... ..... CONSENSUS_MOBI: ....... .....