O14713 ITBP1_HUMAN

Gene name: ITGB1BP1
Protein name: Integrin beta-1-binding protein 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cell division GO:0051301
- cell junction organization GO:0034330
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- cytoskeleton organization GO:0007010
- protein targeting GO:0006605
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P53999 SUB1 0.83905 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
2 Q8IV63 VRK3 0.80264 cell-cell signaling GO:0007267
cellular protein modification process GO:0006464
signal transduction GO:0007165
3 Q9UGV2 NDRG3 0.8015 cell differentiation GO:0030154
growth GO:0040007
reproduction GO:0000003
...
4 Q9UFE4 CCDC39 0.79805 anatomical structure development GO:0048856
cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
...
5 Q9H6Q3 SLA2 0.79544 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
6 Q9ULK2 ATXN7L1 0.79006
7 O43462 MBTPS2 0.78904 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
8 Q9NXV6 CDKN2AIP 0.77458 growth GO:0040007
response to stress GO:0006950
signal transduction GO:0007165
9 Q9Y2F9 BTBD3 0.77266 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
10 Q9UHB7 AFF4 0.77243 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDD............................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................
RICH_[K]:                   KgKKrhsssssqsseistKsK                                                                            
RICH_[S]:                         SSSSSqSSeiStkSkSvdSSlgglSrSStvaSldtdStkSSgqS                                               
RICH_[KS]:                  KgKKrhSSSSSqSSeiStKSKS                                                                           
RICH_[NS]:                                                            StkSSgqSNN                                             
RICH_fLPS_[S]:                    SSSSSqSSeiStkSkSvdSSlgglSrSS                                                               
RICH_MOBI_[K]:              KgKKrhsssssqsseistKsK                                                                            
RICH_MOBI_[S]:                    SSSSSqSSeiStkSkSvdSSlgglSrSS                                                               
RICH_MOBI_[KS]:             KgKKrhSSSSSqSSeiStKSKS                                                                           
RICH_MOBI_[LS]:                                     SSLggLSrSStvaSL                                                          
RICH_fLPS_MOBI_[S]:               SSSSSqSSeiStkSkSvdSSlgglSrSS                                                               

                                          120                 140                 160                 180
AA:                      LPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP
STMI:                                                                                                                        
DO_DISOPRED3:            ..................................................................................................DD
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ..................................................................................................DD
CONSENSUS:               ..................................................................................................DD
CONSENSUS_MOBI:          ....................................................................................................