O15225 INE1_HUMAN
Gene name: INE1
Protein name: Putative inactivation escape 1 protein
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MSGPLSPVCSCPQLPFMLSPCHMHHHPGHVALSQTVSPASLLTQGLGLPQH STMI: DO_DISOPRED3: DDD..............................................DD DO_IUPRED2A: .................................DD.......DD..D.... DO_SPOTD: DDDDDDDDDDDDDDDD...................DDDDDDDDDDDDDDDD CONSENSUS: DDD.......................................DDDDDDDDD CONSENSUS_MOBI: ...................................................