O15239 NDUA1_HUMAN

Gene name: NDUFA1
Protein name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60          
AA:                      MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
STMI:                    MMMMMMMMMMMMMMMMMMMMM                                                 
DO_DISOPRED3:            ......................................................................
DO_IUPRED2A:             ......................................................................
DO_SPOTD:                .....................................................................D
CONSENSUS:                                    .................................................
CONSENSUS_MOBI:                               .................................................