O15431 COPT1_HUMAN
Gene name: SLC31A1
Protein name: High affinity copper uptake protein 1
List of terms from Generic GO subset, which this protein is a part of:
- homeostatic process GO:0042592
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8TDN1 | KCNG4 | 0.65781 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 transmembrane transport GO:0055085 ... |
| 2 | Q9BZW7 | TSGA10 | 0.60131 | cellular component assembly GO:0022607 reproduction GO:0000003 |
| 3 | Q6UXD1 | HRCT1 | 0.58493 | |
| 4 | Q5T2W1 | PDZK1 | 0.57587 | protein targeting GO:0006605 protein transport GO:0015031 transmembrane transport GO:0055085 ... |
| 5 | Q5T681 | C10orf62 | 0.56922 | |
| 6 | Q8TAD4 | SLC30A5 | 0.54569 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | Q8NEW0 | SLC30A7 | 0.54169 | homeostatic process GO:0042592 transport GO:0006810 |
| 8 | P49908 | SELENOP | 0.53405 | anatomical structure development GO:0048856 growth GO:0040007 reproduction GO:0000003 ... |
| 9 | Q8IVC4 | ZNF584 | 0.52457 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | Q6ZSB9 | ZBTB49 | 0.50782 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell population proliferation GO:0008283 ... |
20 40 60 80 100 AA: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVS STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................... DO_IUPRED2A: ...........D..DDDDDDDDDDDDDDDDDDDDDD................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................D CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................... .................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................... .................. RICH_[H]: HsHHmgmsymdsnstmqpsHHHpttsasHsH RICH_[M]: MdhshhMgMsyMdsnstM RICH_[S]: SnStmqpShhhpttSaShS RICH_[GS]: ShShGGGdSS RICH_[HM]: MdHsHHMgMsyMdsnstMqpsHHH RICH_[HS]: SnStmqpSHHHpttSaSHSHgggdSS RICH_fLPS_[HM]: MdHsHHMgMsyMdsnstMqpsHHHpttsasHsH RICH_fLPS_[H]: HsHHmgmsymdsnstmqpsHHHpttsasHsH RICH_fLPS_[M]: MdhshhMgMsyMdsnstMqp RICH_MOBI_[H]: HsHHmgmsymdsnstmqpsHHHpttsasHsH RICH_MOBI_[M]: MdhshhMgMsyMdsnstM RICH_MOBI_[HM]: MdHsHHMgMsyMdsnstMqpsHHH RICH_MOBI_[HS]: SnStmqpSHHHpttSaSHSH RICH_fLPS_MOBI_[HM]: MdHsHHMgMsyMdsnstMqpsHHHpttsasHsH RICH_fLPS_MOBI_[H]: HsHHmgmsymdsnstmqpsHHHpttsasHsH RICH_fLPS_MOBI_[M]: MdhshhMgMsyMdsnstMqp
120 140 160 180 AA: IRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ......DDDDDDDDDDDDDDDDDDD...........................................................D.DDDD DO_IUPRED2A: .......................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.....................................................DDDDDDDDDDD CONSENSUS: ......DDDDDDDDDDDDDDDDDDD....... ... .......DDDDDD CONSENSUS_MOBI: ................................ ... .............