O15511 ARPC5_HUMAN
Gene name: ARPC5
Protein name: Actin-related protein 2/3 complex subunit 5
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- immune system process GO:0002376
- membrane organization GO:0061024
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q99594 | TEAD3 | 0.83341 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q96EK5 | KIFBP | 0.81545 | anatomical structure development GO:0048856 cell differentiation GO:0030154 embryo development GO:0009790 ... |
| 3 | Q9UIX4 | KCNG1 | 0.78117 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 transmembrane transport GO:0055085 ... |
| 4 | P29597 | TYK2 | 0.75471 | cellular protein modification process GO:0006464 immune system process GO:0002376 response to stress GO:0006950 ... |
| 5 | A6NDA9 | LRIT2 | 0.72254 | |
| 6 | O60279 | SUSD5 | 0.70895 | cell adhesion GO:0007155 signal transduction GO:0007165 |
| 7 | Q9NZM1 | MYOF | 0.70621 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 carbohydrate metabolic process GO:0005975 ... |
| 8 | P0C264 | SBK3 | 0.70483 | |
| 9 | Q6UXM1 | LRIG3 | 0.67551 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 10 | Q14582 | MXD4 | 0.67147 | biosynthetic process GO:0009058 cell population proliferation GO:0008283 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDK STMI: DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: .....................DDDDDDDDDDDDDDDDDDDDDDDDDD.........DDDD...D.DDD................................ DO_SPOTD: DDDDDDDDDD.....DD.DDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: DDDDDD...............DDDDDDDDDDDDDDD................................................................ CONSENSUS_MOBI: ....................DDDDDDDDDDDDDDDDDDDDDDDD........................................................ RICH_MOBI_[D]: DeeDggDgqagpDegevD RICH_MOBI_[G]: GGdGqaGpdeG RICH_MOBI_[DE]: EnkfvDEEDggDgqagpDEgEvD RICH_MOBI_[DG]: DeeDGGDGqaGpDeGevD RICH_MOBI_[EG]: EnkfvdEEdGGdGqaGpdEGE
120 140 AA: NGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV STMI: DO_DISOPRED3: ................................................... DO_IUPRED2A: ................................................... DO_SPOTD: ................................................... CONSENSUS: ................................................... CONSENSUS_MOBI: ...................................................