O15525 MAFG_HUMAN

Gene name: MAFG
Protein name: Transcription factor MafG

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- embryo development GO:0009790
- homeostatic process GO:0042592
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A6NH21 SERINC4 0.61374 biosynthetic process GO:0009058
2 Q96NY9 MUS81 0.60774 catabolic process GO:0009056
cell cycle GO:0007049
cell population proliferation GO:0008283
...
3 A1A5B4 ANO9 0.5895 membrane organization GO:0061024
plasma membrane organization GO:0007009
transmembrane transport GO:0055085
...
4 Q14764 MVP 0.58535 cellular protein modification process GO:0006464
immune system process GO:0002376
protein transport GO:0015031
...
5 Q9Y5Y0 FLVCR1 0.57366 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...
6 Q99581 FEV 0.57314 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
7 Q9NP78 ABCB9 0.5572 protein transport GO:0015031
transmembrane transport GO:0055085
transport GO:0006810
8 P17482 HOXB9 0.55443 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
9 P33316 DUT 0.55406 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
10 Q9H7Z7 PTGES2 0.54608 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...

                                           20                  40                  60                  80                 100
AA:                      MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASM
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD.............................................DDDDD.................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD..D....D.D...DD.D...................D.DDDDDDDDDDDDDDDDD.......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDD..............................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDD..............................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDD............................................................................
RICH_[KN]:                   NKgNKalKvK                                                                                      
RICH_MOBI_[KN]:              NKgNKalKvK                                                                                      

                                          120                 140                 160                  
AA:                      KLELDALRSKYEALQTFARTVARSPVAPARGPLAAGLGPLVPGKVAATSVITIVKSKTDARS
STMI:                                                                                  
DO_DISOPRED3:            .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .....................D.....DD..DDD...........................D
DO_SPOTD:                .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..............................................................
RICH_[AG]:                                         ApArGplAAGlGplvpGkvAA               
RICH_[AP]:                                    ArsPvAPArgPlAAglgPlvPgkvAA               
RICH_[A]:                                     ArspvApArgplAA                           
RICH_[V]:                                                        VpgkVaatsVitiV        
RICH_[GL]:                                             GpLaaGLGpL                      
RICH_[GP]:                                       PvaParGPlaaGlGPlvPG                   
RICH_[IV]:                                                       VpgkVaatsVItIV