O43665 RGS10_HUMAN
Gene name: RGS10
Protein name: Regulator of G-protein signaling 10
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P48553 | TRAPPC10 | 0.81911 | cellular component assembly GO:0022607 membrane organization GO:0061024 protein-containing complex assembly GO:0065003 ... |
| 2 | P61073 | CXCR4 | 0.72166 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 3 | Q9Y5X0 | SNX10 | 0.70913 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 4 | Q8TBK6 | ZCCHC10 | 0.66891 | |
| 5 | O95177 | GAS8-AS1 | 0.66758 | |
| 6 | O14948 | TFEC | 0.66043 | response to stress GO:0006950 |
| 7 | Q9ULI2 | RIMKLB | 0.65781 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 8 | P51811 | XK | 0.6445 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 9 | Q8IZU9 | KIRREL3 | 0.63866 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 10 | Q8N4U5 | TCP11L2 | 0.63751 | signal transduction GO:0007165 |
20 40 60 80 100 AA: MQSELCFADIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: ................DDD.DD.............................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... RICH_[S]: SelcfadihdSdgSSSSS RICH_[DH]: DiHDsDgsssssH RICH_[DS]: DihDSDgSSSSS RICH_[HS]: HdSdgSSSSSH RICH_fLPS_[S]: hdSdgSSSSS RICH_MOBI_[S]: SdgSSSSShqSlkS RICH_MOBI_[DH]: DiHDsDgsssssH RICH_MOBI_[DS]: DihDSDgSSSSShqS RICH_MOBI_[HS]: HdSdgSSSSSHqS RICH_fLPS_MOBI_[S]: dSdgSSSSShqSlkS
120 140 160 AA: EGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT STMI: DO_DISOPRED3: .....................................................DDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...DDDD..........................................DDD.DDDDDDDDDDDD..D..... DO_SPOTD: ...................................................DDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...................................................DDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..................................................................DDDDDDD RICH_[AE]: EEEEdlpdAqtAAkrA