O43677 NDUC1_HUMAN

Gene name: NDUFC1
Protein name: NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60    
AA:                      MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGLE
STMI:                    TTTTTTTTTTTTTTTTTTTTTTTTTTT             MMMMMMMMMMMMMMMMMMM                 
DO_DISOPRED3:            DDDDD..DDDDDDDDDDDD.DDD....................................................D
DO_IUPRED2A:             .............................D..............................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDD................................................DDDD
CONSENSUS:                                          .............                   ................D
CONSENSUS_MOBI:                                     .............                   .................