List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60    
AA:                      MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS
STMI:                                                                                                
DO_DISOPRED3:            D................................................................DDDDDDDDDDD
DO_IUPRED2A:             ..............................................................DDDDDDDDDDDDDD
DO_SPOTD:                DDDD.......................................................DDDDDDDDDDDDDDDDD
CONSENSUS:               D.............................................................DDDDDDDDDDDDDD
CONSENSUS_MOBI:          .......................................................................DDDDD