O43809 CPSF5_HUMAN
Gene name: NUDT21
Protein name: Cleavage and polyadenylation specificity factor subunit 5
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- immune system process GO:0002376
- mRNA processing GO:0006397
- protein-containing complex assembly GO:0065003
- ribonucleoprotein complex assembly GO:0022618
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q15436 | SEC23A | 0.93888 | cellular component assembly GO:0022607 immune system process GO:0002376 membrane organization GO:0061024 ... |
| 2 | Q99062 | CSF3R | 0.83205 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 3 | Q9GZQ4 | NMUR2 | 0.79612 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 4 | Q9NP58 | ABCB6 | 0.78935 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | P35228 | NOS2 | 0.78633 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 6 | Q9NWZ3 | IRAK4 | 0.78488 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 7 | O00180 | KCNK1 | 0.74901 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 8 | P16473 | TSHR | 0.74126 | cell population proliferation GO:0008283 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 9 | Q92959 | SLCO2A1 | 0.71202 | transport GO:0006810 |
| 10 | Q8NCL4 | GALNT6 | 0.70711 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
20 40 60 80 100 AA: MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... DO_IUPRED2A: DD.DDDDDD..DDD...................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDD................................................................................... RICH_[Q]: QtgwprgvtQfgnkyiQQ
120 140 160 180 200 AA: TTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ................D................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: LYDNAPGYGPIISSLPQLLSRFNFIYN STMI: DO_DISOPRED3: ........................... DO_IUPRED2A: ........................... DO_SPOTD: ........................... CONSENSUS: ........................... CONSENSUS_MOBI: ...........................