O43908 NKG2F_HUMAN

Gene name: KLRC4
Protein name: NKG2-F type II integral membrane protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5SSQ6 SAPCD1 0.93293
2 Q9UGC6 RGS17 0.93248 signal transduction GO:0007165
3 Q9HAV7 GRPEL1 0.93219 protein folding GO:0006457
protein targeting GO:0006605
protein transport GO:0015031
...
4 Q99541 PLIN2 0.92765 transport GO:0006810
5 P26717 KLRC2 0.90553 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
6 Q6IN84 MRM1 0.89599 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
7 Q9NYK6 EURL 0.89329 anatomical structure development GO:0048856
cell differentiation GO:0030154
8 Q07444 KLRC3 0.8867 response to stress GO:0006950
9 Q5W0B7 TMEM236 0.86903
10 Q9Y2P7 ZNF256 0.83847 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVL
STMI:                                                                                              MMMMMMMMMMMMMMMMMMMMM     
DO_DISOPRED3:            DDDD............D..DDDDDDDDDDDD.....................................................................
DO_IUPRED2A:             .D....DDDDDDDDDDDDDD...DDDD.........................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................                     .....
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDD.................................................                     .....
RICH_[K]:                                 KrqqrKlKgnK                                                                        
RICH_[Q]:                   QrgtysevslaQdpkrQQ                                                                               
RICH_MOBI_[Q]:              QrgtysevslaQdpkrQQ                                                                               

                                          120                 140  
AA:                      EQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
STMI:                                                                              
DO_DISOPRED3:            ..........................................................
DO_IUPRED2A:             ..........................................................
DO_SPOTD:                DDDDDDDDDDDDDDD...........................................
CONSENSUS:               ..........................................................
CONSENSUS_MOBI:          ..........................................................