List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q8IW00	VSTM4	0.90286
2	O60701	UGDH	0.72505	anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ...
3	Q7Z418	KCNK18	0.70711	transmembrane transport GO:0055085 transport GO:0006810
4	Q8TCC7	SLC22A8	0.7027	circulatory system process GO:0003013 transport GO:0006810
5	P25942	CD40	0.69793	anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ...
6	Q8WUY9	DEPDC1B	0.69253	cell-cell signaling GO:0007267 signal transduction GO:0007165
7	Q96Q35	FLACC1	0.67814
8	Q8IUF8	RIOX2	0.67091	ribosome biogenesis GO:0042254
9	O95433	AHSA1	0.66927	biological process involved in symbiotic interaction GO:0044403 protein folding GO:0006457
10	P35236	PTPN7	0.64194	cellular protein modification process GO:0006464

                                           20                  40                  60                  80                 100
AA:                      MWLSTSPYRKGSQCGEAFSQIPGHNLNKKTPPGVKPPESHVCGEVGVGYPSTERHIRDRLGRKPCEYQECRQKAYTCKPCGNAFRFHHSFHIHERPHSGE
STMI:                                                                                                                        
DO_DISOPRED3:            DDD..........................................................DDDDDDDDDDDDD..........................
DO_IUPRED2A:             .....................DD.DDDDDDDDDDDDDD..............DD....................................D.........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDD..................DDDDDDDDDDDDDDDDD..............DD.......DDDDDDDDDDDDD................D.........
CONSENSUS_MOBI:          ....................................................................................................
RICH_[KP]:                                          KKtPPgvKPP                                                               

                                        
AA:                      NLYEC
STMI:                         
DO_DISOPRED3:            .....
DO_IUPRED2A:             .....
DO_SPOTD:                DD.D.
CONSENSUS:               .....
CONSENSUS_MOBI:          .....