O60516 4EBP3_HUMAN

Gene name: EIF4EBP3
Protein name: Eukaryotic translation initiation factor 4E-binding protein 3

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P15509 CSF2RA 0.71539
2 Q8NCY6 MSANTD4 0.71297
3 Q9Y2C2 UST 0.69911 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 O15259 NPHP1 0.67551 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
5 A1Z1Q3 MACROD2 0.66657 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
6 P0DMR3 ATXN8OS 0.66321
7 Q5T7N2 L1TD1 0.66175
8 P43307 SSR1 0.65816 cell population proliferation GO:0008283
protein targeting GO:0006605
protein transport GO:0015031
...
9 Q14571 ITPR2 0.65761 cell-cell signaling GO:0007267
circulatory system process GO:0003013
homeostatic process GO:0042592
...
10 Q9Y4W2 LAS1L 0.65318 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254

                                           20                  40                  60                  80
AA:                      MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD..................................................DD.............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDD..DDDDDDDDDDDDDDDD...DDD..........................DDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDD......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDD...........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ................................................................................DDDDDDDDDDDDDDDDDDDD
RICH_[PT]:                                                                      TPPcclPqiPgvTTPPTaP                          
RICH_[E]:                                                                                              EElkEqEtEEEipddaqfE   
RICH_[P]:                                                                        PPcclPqiPgvttPPtaP                          
RICH_[T]:                                                                       TppcclpqipgvTTppT                            
RICH_[CP]:                                                                       PPCClPqiPgvttPPtaP                          
RICH_[CT]:                                                                      TppCClpqipgvTTppT                            
RICH_[DE]:                                                                                                   EtEEEipDDaqfEmD 
RICH_[DI]:                                                                                                        IpDDaqfemDI
RICH_[ET]:                                                                                  TTppTaplsklEElkEqETE             
RICH_fLPS_[E]:                                                                                        lEElkEqEtEEEipddaqfE   
RICH_MOBI_[E]:                                                                                             EqEtEEEipddaqfE   
RICH_MOBI_[DE]:                                                                                              EtEEEipDDaqfEmD 
RICH_MOBI_[DI]:                                                                                                   IpDDaqfemDI
RICH_MOBI_[EI]:                                                                                            EqEtEEEIpddaqfEmdI
RICH_fLPS_MOBI_[E]:                                                                                      lkEqEtEEEi