O60675 MAFK_HUMAN
Gene name: MAFK
Protein name: Transcription factor MafK
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6P2S7 | TTC41P | 0.91756 | |
| 2 | P46059 | SLC15A1 | 0.89443 | protein transport GO:0015031 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | P78348 | ASIC1 | 0.89443 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 nervous system process GO:0050877 ... |
| 4 | Q6ZU15 | SEPTIN14 | 0.88492 | cell cycle GO:0007049 cell division GO:0051301 |
| 5 | Q86V20 | SHLD2 | 0.88492 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 6 | Q5FWF6 | ZNF789 | 0.87416 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 7 | Q5JPI3 | C3orf38 | 0.86193 | cell death GO:0008219 |
| 8 | Q8TCF1 | ZFAND1 | 0.86193 | protein transport GO:0015031 transport GO:0006810 |
| 9 | Q9NV72 | ZNF701 | 0.85838 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | O43852 | CALU | 0.85328 | cellular protein modification process GO:0006464 |
20 40 60 80 100 AA: MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSM STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD.D................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDD..DDDDD.DDD....D....DD.DDDDDDDDDDDDDDD.....................D.DD.DDDDDDDDDD.D..... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[K]: KpnKalKvKK
120 140 AA: RLELDALRSKYEALQTFARTVARGPVAPSKVATTSVITIVKSTELSSTSVPFSAAS STMI: DO_DISOPRED3: .......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ........................D............................... DO_SPOTD: ..........................................DDDDDDDDDDDDDD CONSENSUS: ........................D.................DDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................