O60762 DPM1_HUMAN
Gene name: DPM1
Protein name: Dolichol-phosphate mannosyltransferase subunit 1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular protein modification process GO:0006464
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | P33681 | CD80 | 0.99956 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
2 | Q9NUL7 | DDX28 | 0.99388 |
cellular component assembly
GO:0022607 protein-containing complex assembly GO:0065003 ribonucleoprotein complex assembly GO:0022618 ... |
3 | Q9Y3A4 | RRP7A | 0.97125 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular component assembly GO:0022607 ... |
4 | P50749 | RASSF2 | 0.92507 |
anatomical structure development
GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
5 | Q15036 | SNX17 | 0.92348 |
anatomical structure development
GO:0048856 catabolic process GO:0009056 protein transport GO:0015031 ... |
6 | Q9H7R5 | ZNF665 | 0.91778 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
7 | B1APH4 | ZNF487 | 0.88865 | |
8 | Q9H0I3 | CCDC113 | 0.88104 |
cellular component assembly
GO:0022607 |
9 | O00339 | MATN2 | 0.87747 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
10 | Q6T310 | RASL11A | 0.8622 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165 |
20 40 60 80 100
AA: MASLEVSRSPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSDRILLRPREKKLGLGT
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDD.............................................................................
DO_IUPRED2A: ...DDD.....DDDDDDDD......................................................DDD........................
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD.............................................................................
CONSENSUS_MOBI: ....................................................................................................
RICH_[R]: RspRRsRRelevRspR
RICH_fLPS_[R]: levsRspRRsRRelevRspR
120 140 160 180 200
AA: AYIHGMKHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIE
STMI:
DO_DISOPRED3: ....................................................................................................
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: ....................................................................................................
CONSENSUS: ....................................................................................................
CONSENSUS_MOBI: ....................................................................................................
220 240
AA: KCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT
STMI:
DO_DISOPRED3: ...........................................................D
DO_IUPRED2A: ............................................................
DO_SPOTD: ............................................................
CONSENSUS: ............................................................
CONSENSUS_MOBI: ............................................................