O75340 PDCD6_HUMAN
Gene name: PDCD6
Protein name: Programmed cell death protein 6
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- embryo development GO:0009790
- membrane organization GO:0061024
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9GZZ0 | HOXD1 | 0.76378 | anatomical structure development GO:0048856 cell differentiation GO:0030154 embryo development GO:0009790 ... |
| 2 | Q99581 | FEV | 0.73729 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 3 | O60548 | FOXD2 | 0.70147 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 4 | Q13064 | MKRN3 | 0.69452 | cellular protein modification process GO:0006464 |
| 5 | P31271 | HOXA13 | 0.67813 | anatomical structure development GO:0048856 |
| 6 | P16260 | SLC25A16 | 0.67739 | transport GO:0006810 |
| 7 | P33897 | ABCD1 | 0.67724 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | Q9NSD7 | RXFP3 | 0.6718 | cell cycle GO:0007049 cell division GO:0051301 signal transduction GO:0007165 |
| 9 | Q9UNW9 | NOVA2 | 0.67136 | cellular nitrogen compound metabolic process GO:0034641 homeostatic process GO:0042592 mRNA processing GO:0006397 |
| 10 | Q6ICG8 | WBP2NL | 0.67083 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: .....D..D....DDDDD...........................D...................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS_MOBI: .DDDDDDDDDDDDDDDDDDD................................................................................ RICH_[PY]: YsYrPgPgagPgP RICH_[AG]: AAysyrpGpGAGpGpAAGAA RICH_[AP]: AAysyrPgPgAgPgPAAgAA RICH_[AY]: AAYsYrpgpgAgpgpAAgAA RICH_[A]: AAysyrpgpgAgpgpAAgAA RICH_[G]: GpGaGpGpaaG RICH_[GP]: PGPGaGPGPaaG RICH_[GY]: YsYrpGpGaGpGpaaG RICH_fLPS_[A]: AAysyrpgpgAgpgpAAgAA RICH_MOBI_[AG]: GpGAGpGpAAGA RICH_MOBI_[G]: GpGaGpGpaaG RICH_MOBI_[GY]: YsYrpGpGaG
120 140 160 180 AA: TYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV STMI: DO_DISOPRED3: ........................................................................................... DO_IUPRED2A: ........................................................................................... DO_SPOTD: ........................................................................................... CONSENSUS: ........................................................................................... CONSENSUS_MOBI: ...........................................................................................