O75438 NDUB1_HUMAN

Gene name: NDUFB1
Protein name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40  
AA:                      MVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
STMI:                              MMMMMMMMMMMMMMMMM                               
DO_DISOPRED3:            D.........................................................
DO_IUPRED2A:             ..........................................................
DO_SPOTD:                ..............................................DDDDDDDDDDDD
CONSENSUS:               ..........                 ...............................
CONSENSUS_MOBI:          ..........                 ...............................