List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- embryo development GO:0009790
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60    
AA:                      MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQKS
STMI:                                                                                                
DO_DISOPRED3:            DDDDD...........................................................DDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDD.DDDDDD......D.......DDDD..DDDDD....DDDDD.DD..DDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDD.....................................................DDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDD.....................................................DDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDD.....................................................DDDDDDDDDDDDDDDDDD