O75956 CDKA2_HUMAN

Gene name: CDK2AP2
Protein name: Cyclin-dependent kinase 2-associated protein 2

List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell division GO:0051301
- cytoskeleton organization GO:0007010
- mitotic cell cycle GO:0000278

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q14195 DPYSL3 0.80093 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
2 Q9HBB8 CDHR5 0.79221 cell adhesion GO:0007155
cell differentiation GO:0030154
cellular component assembly GO:0022607
3 Q9NWS9 ZNF446 0.78168
4 Q1L6U9 MSMP 0.77193 immune system process GO:0002376
response to stress GO:0006950
5 Q9GZZ6 CHRNA10 0.7322 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cell-cell signaling GO:0007267
...
6 A6NDV4 TMEM8B 0.71738 cell adhesion GO:0007155
cell cycle GO:0007049
growth GO:0040007
...
7 Q6UXD5 SEZ6L2 0.71693
8 Q9UKS6 PACSIN3 0.71476 catabolic process GO:0009056
cytoskeleton organization GO:0007010
membrane organization GO:0061024
...
9 P50479 PDLIM4 0.70901 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
cytoskeleton organization GO:0007010
10 Q9HCI5 MAGEE1 0.70786

                                           20                  40                  60                  80                 100
AA:                      MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAME
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
DO_IUPRED2A:             .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDDDDDDDD...DD.DDDDDDDDDD.DD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................
RICH_[PT]:                      PaPssTPgssTPgPgTPvPTgsvP                                                                     
RICH_[PV]:                                      PVPtgsVPsPsgsVP                                                              
RICH_[P]:                    PiaPaPsstPgsstPgPgtPvPtgsvPsP                                                                   
RICH_[T]:                            TpgssTpgpgTpvpT                                                                         
RICH_[GP]:                        PsstPGsstPGPGtPvPtGsvPsPsGsvPGaGaPfrP     GPPsmGyvqamkPPGaqG                               
RICH_[GT]:                           TpGssTpGpGTpvpTG                                                                        
RICH_fLPS_[F]:                                                    apFrplFndF                                                 
RICH_MOBI_[PT]:                 PaPssTPgssTPgPgTPvPT                                                                         
RICH_MOBI_[PV]:                                 PVPtgsVPsPsgsVP                                                              
RICH_MOBI_[P]:               PiaPaPsstPgsstPgPgtPvPtgsvPsP                                                                   
RICH_MOBI_[T]:                       TpgssTpgpgTpvpT                                                                         
RICH_MOBI_[GP]:                   PsstPGsstPGPGtPvPtG                                                                        
RICH_MOBI_[GT]:                      TpGssTpGpGTpvpTG                                                                        

                                          120              
AA:                      RLKRGIIHARALVRECLAETERNART
STMI:                                              
DO_DISOPRED3:            ......................DDDD
DO_IUPRED2A:             ...DD.......D...DDDDDDDDDD
DO_SPOTD:                .....................DDDDD
CONSENSUS:               .....................DDDDD
CONSENSUS_MOBI:          ..........................