O94777 DPM2_HUMAN

Gene name: DPM2
Protein name: Dolichol phosphate-mannose biosynthesis regulatory protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80                
AA:                      MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKTKRVTKKAQ
STMI:                              MMMMMMMMMMMMMMMMMMMMM                 MMMMMMMMMMMMMMMMMMMMM               
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDD.....................................DDDDDDDD...............DDDDD
DO_IUPRED2A:             ....................................................................................
DO_SPOTD:                DDDD...........................................................DDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD......                     .................                     ..........DDDDD
CONSENSUS_MOBI:          ..........                     .................                     ...............