O95167 NDUA3_HUMAN

Gene name: NDUFA3
Protein name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- generation of precursor metabolites and energy GO:0006091
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80                
AA:                      MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
STMI:                                      MMMMMMMMMMMMMMMMMMMMM                                             
DO_DISOPRED3:            DD..................................................................................
DO_IUPRED2A:             ..........................................................DDDDDDDDDDDDDDDD..D.......
DO_SPOTD:                DDD.......................................................DDDDDDDDDDDDDDDD..........
CONSENSUS:               DD................                     ...................DDDDDDDDDDDDDDDD..........
CONSENSUS_MOBI:          ..................                     .............................................