O95415 BRI3_HUMAN

Gene name: BRI3
Protein name: Brain protein I3

List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A6NMB9 FIGNL2 0.70459 cellular nitrogen compound metabolic process GO:0034641
cytoskeleton organization GO:0007010
DNA metabolic process GO:0006259
...
2 Q99816 TSG101 0.69132 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
3 P55771 PAX9 0.67697 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 Q9UL17 TBX21 0.66838 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 P04626 ERBB2 0.64903 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 Q96DD7 SHISA4 0.64543
7 P17509 HOXB6 0.64091 anatomical structure development GO:0048856
embryo development GO:0009790
homeostatic process GO:0042592
...
8 Q13285 NR5A1 0.63444 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
9 Q6ICG8 WBP2NL 0.6294 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular component assembly GO:0022607
...
10 A8MYP8 ODF3B 0.62479

                                           20                  40                  60                  80                 100
AA:                      MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAII
STMI:                                                                                      MMMMMMMMMMMMMMMMMMMM     MMMMMMMMM
DO_DISOPRED3:            DDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D..............................
DO_IUPRED2A:             .D..................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................
CONSENSUS:               DDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...                    .....         
CONSENSUS_MOBI:          ..................................................................                    .....         
RICH_[PY]:                                     YacgPhgYgaiPaaPPPPPYPYlvtgiPthhPrvY                                           
RICH_[AG]:                           AynleAGqGdyAcGphGyGA                                                                    
RICH_[AP]:                                      AcgPhgygAiPAAPPPPPyP                                                         
RICH_[AY]:                           AYnleAgqgdYAcgphgYgA                                                                    
RICH_[G]:                                  GqGdyacGphGyG                                                                     
RICH_[P]:                                          PhgygaiPaaPPPPPyPylvtgiPthhP                                              
RICH_[Y]:                             YnleagqgdY      YgaipaapppppYpY                                                        
RICH_[GP]:                                 GqGdyacGPhGyGaiPaaPPPP                                                            
RICH_[GY]:                            YnleaGqGdYacGphGYG                                                                     
RICH_[HI]:                                                               IptHHprvynIH                                        
RICH_[HP]:                                                     PPPyPylvtgiPtHHP                                              
RICH_fLPS_[P]:                                     PhgygaiPaaPPPPPyPylvtgiPthhP                                              

                                          120               
AA:                      LFPFGFICCFALRKRRCPNCGATFA
STMI:                    MMMMMMMMMMMM             
DO_DISOPRED3:            .........................
DO_IUPRED2A:             .........................
DO_SPOTD:                .....................D..D
CONSENSUS:                           .............
CONSENSUS_MOBI:                      .............