O95416 SOX14_HUMAN

Gene name: SOX14
Protein name: Transcription factor SOX-14

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- nervous system process GO:0050877

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P17482 HOXB9 0.49699 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
2 Q6VUC0 TFAP2E 0.49204 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular nitrogen compound metabolic process GO:0034641
3 Q9GZZ0 HOXD1 0.47372 anatomical structure development GO:0048856
cell differentiation GO:0030154
embryo development GO:0009790
...
4 P33897 ABCD1 0.45565 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 Q9UBT7 CTNNAL1 0.45531 cell adhesion GO:0007155
signal transduction GO:0007165
6 Q8TEW6 DOK4 0.4533 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
7 Q5U5X8 FAM222A 0.44886
8 Q9BQI4 CCDC3 0.43792 biosynthetic process GO:0009058
cell differentiation GO:0030154
signal transduction GO:0007165
9 A0A0B4J2F2 SIK1B 0.43724 cellular protein modification process GO:0006464
signal transduction GO:0007165
10 Q01892 SPIB 0.43292 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD.DDD.......................................................................DDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDD....DDDD...DDDDDDDDDDDDDDDDDDDD....................DDDDDDDD.DDDDDDDDDDDDDDD..................
DO_SPOTD:                DDDDDDD.....................DDDDDDD.................DDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDD.....................DDDDDDD.....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[PR]:                                                                                            RPRRkPknllkkdRyvfPlP   
RICH_[PY]:                                                                                             PrrkPknllkkdrYvfPlPY  
RICH_[RY]:                                                                                         YkYRpRRkpknllkkdRY        
RICH_[K]:                                                                                           KyrprrKpKnllKK           
RICH_[R]:                                                                                             RpRRkpknllkkdR         
RICH_[DY]:                                                                                                        DrYvfplpYlg
RICH_[GL]:                                                                                                                 LG
RICH_[KL]:                                                                                                KpKnLLKKdryvfpLpyL 
RICH_[KP]:                                                                                             PrrKPKnllKKdryvfPlP   
RICH_[KR]:                                                                                          KyRpRRKpKnllKKdR         
RICH_[KY]:                                                                                         YKYrprrKpKnllKKdrY        
RICH_[LP]:                                                                                                             PLPyLg
RICH_[LY]:                                                                                                    LLkkdrYvfpLpYLg

                                          120                 140                 160                 180                 200
AA:                      DTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVV
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ......D..D..D..D........D.........................................................DDDDDDDDDDDDD.....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[PT]:                                                                                                     ThThPsPTnPgyvv
RICH_[AG]:                                                                          AtGAlpyAstlGyqnGAfG                      
RICH_[AL]:                   LkAAgLpvgAsdgLLsA                                                                               
RICH_[AP]:                                   APekArAflPPAsAPyslldPA                                                          
RICH_[AY]:                                                                          AtgAlpYAstlgYqngA                        
RICH_[A]:                                    ApekArAflppAsA                                                                  
RICH_[T]:                                                                                                      ThThpspTnpgyvv
RICH_[CN]:                                                                                                             Npgyvv
RICH_[CP]:                                                                                                         PsPtnPgyvv
RICH_[CT]:                                                                                                     ThThpspTnpgyvv
RICH_[DY]:               DtD                                                                                                 
RICH_[GL]:               dtdpLkaaGLpvGasdGLL                                                                                 
RICH_[GY]:                                                                            GalpYastlGYqnGafG                      
RICH_[LP]:               dtdPLkaagLP                                                                                         
RICH_[LY]:               dtdpL                                                                                               

                                          220
AA:                      PCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM
STMI:                                                            
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ........................................
DO_SPOTD:                DDDDDDDDDDDDDDDD.......DDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD.......DDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ........................................
RICH_[PT]:               PcncT                                   
RICH_[T]:                pcncT                                   
RICH_[CN]:               pCNC                                    
RICH_[CP]:               PCnC                                    
RICH_[CT]:               pCnCT