O95751 LDOC1_HUMAN
Gene name: LDOC1
Protein name: Protein LDOC1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell population proliferation GO:0008283
- reproduction GO:0000003
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5VT99 | LRRC38 | 0.8825 | transmembrane transport GO:0055085 transport GO:0006810 |
| 2 | Q6NVV0 | MKRN9P | 0.87732 | |
| 3 | Q9UBS8 | RNF14 | 0.8772 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q2NL67 | PARP6 | 0.8738 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 5 | O75794 | CDC123 | 0.8677 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell division GO:0051301 ... |
| 6 | Q9C0I1 | MTMR12 | 0.79739 | biosynthetic process GO:0009058 transport GO:0006810 |
| 7 | Q6ZMW3 | EML6 | 0.75028 | |
| 8 | P51861 | CDR1 | 0.73559 | |
| 9 | Q8N485 | LIX1 | 0.72056 | catabolic process GO:0009056 |
| 10 | Q9Y6J8 | STYXL1 | 0.72056 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEA STMI: DO_DISOPRED3: .............................D.DDDDDDDDDDDDDDDDD.................................................... DO_IUPRED2A: ...................................................DD.DD............................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................... CONSENSUS: .............................DDDDDDDDDDDDDDDDDDD.................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[L]: LrLLvcerasLL
120 140 AA: EEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY STMI: DO_DISOPRED3: .....................................DDDDDDDDD DO_IUPRED2A: ...............................DDDDDDDDDDDDDDD DO_SPOTD: ................................DDDDDDDDDDDDDD CONSENSUS: ................................DDDDDDDDDDDDDD CONSENSUS_MOBI: .............................................. RICH_[D]: DDeDDDDeeeeDD RICH_[DE]: DDEDDDDEEEEDD RICH_fLPS_[D]: DDeDDDDeeeeDD