O95866 G6B_HUMAN
Gene name: MPIG6B
Protein name: Megakaryocyte and platelet inhibitory receptor G6b
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- homeostatic process GO:0042592
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IV08 | PLD3 | 0.8939 | anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376 ... |
| 2 | Q9BT04 | FUZ | 0.88492 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 3 | Q5T5D7 | ZNF684 | 0.88492 | |
| 4 | Q8N490 | PNKD | 0.84109 | catabolic process GO:0009056 cell-cell signaling GO:0007267 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | P31994 | FCGR2B | 0.82163 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 ... |
| 6 | P15735 | PHKG2 | 0.80763 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 ... |
| 7 | Q9NX14 | NDUFB11 | 0.79815 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 |
| 8 | Q9Y226 | SLC22A13 | 0.79534 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 immune system process GO:0002376 ... |
| 9 | Q8N402 | n/a | 0.79149 | |
| 10 | Q8NFB2 | TMEM185A | 0.78207 |
20 40 60 80 100 AA: MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSA STMI: SSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDD...DDD................................................................................... DO_IUPRED2A: ..................D.DDDDDDD......................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS: .DDDD.............................................................................. CONSENSUS_MOBI: ...................................................................................
120 140 160 180 200 AA: GDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPPQPIRPLPRFAPLVKTEPQRPVKEEEPKIP STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..........................................................................................DDDDDDDD.. DO_IUPRED2A: ...............................................................................DD...DDDDDDDDDDDDDDDD DO_SPOTD: ...................................DDDD..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .......................................... ................DDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .......................................... ..................................... RICH_[E]: EpqrpvkEEE RICH_[EP]: PlvktEPqrPvkEEEPkiP
220 240 AA: GDLDQEPSLLYADLDHLALSRPRRLSTADPADASTIYAVVV STMI: DO_DISOPRED3: D........................................ DO_IUPRED2A: D.D.....................D................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..... CONSENSUS: DDD.....................D................ CONSENSUS_MOBI: .........................................