O95994 AGR2_HUMAN

Gene name: AGR2
Protein name: Anterior gradient protein 2 homolog

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- growth GO:0040007
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6P2S7 TTC41P 0.91756
2 P46059 SLC15A1 0.89443 protein transport GO:0015031
transmembrane transport GO:0055085
transport GO:0006810
3 P78348 ASIC1 0.89443 cell-cell signaling GO:0007267
cellular component assembly GO:0022607
nervous system process GO:0050877
...
4 Q86V20 SHLD2 0.88492 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
5 Q5FWF6 ZNF789 0.87416 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 Q5JPI3 C3orf38 0.86193 cell death GO:0008219
7 Q8TCF1 ZFAND1 0.86193 protein transport GO:0015031
transport GO:0006810
8 Q9NV72 ZNF701 0.85838 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
9 O43852 CALU 0.85328 cellular protein modification process GO:0006464
10 P21246 PTN 0.8403 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...

                                           20                  40                  60                  80                 100
AA:                      MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKL
STMI:                    SSSSSSSSSSSSSSSSSSSS                                                                                
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................
DO_IUPRED2A:             .........................DDDDDDDDDDDDDDDDD..........................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................
CONSENSUS:                                   DDDDDDDDDDDDDDDDDDDD............................................................
CONSENSUS_MOBI:                              ................................................................................
RICH_[K]:                                         KpgaKKdtKdsrpK                                                             

                                          120                 140                 160     
AA:                      AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
STMI:                                                                                               
DO_DISOPRED3:            ...........................................................................
DO_IUPRED2A:             ...........................................................................
DO_SPOTD:                .........................................................................DD
CONSENSUS:               ...........................................................................
CONSENSUS_MOBI:          ...........................................................................