O95994 AGR2_HUMAN
Gene name: AGR2
Protein name: Anterior gradient protein 2 homolog
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- growth GO:0040007
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6P2S7 | TTC41P | 0.91756 | |
| 2 | P46059 | SLC15A1 | 0.89443 | protein transport GO:0015031 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | P78348 | ASIC1 | 0.89443 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 nervous system process GO:0050877 ... |
| 4 | Q86V20 | SHLD2 | 0.88492 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 5 | Q5FWF6 | ZNF789 | 0.87416 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q5JPI3 | C3orf38 | 0.86193 | cell death GO:0008219 |
| 7 | Q8TCF1 | ZFAND1 | 0.86193 | protein transport GO:0015031 transport GO:0006810 |
| 8 | Q9NV72 | ZNF701 | 0.85838 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | O43852 | CALU | 0.85328 | cellular protein modification process GO:0006464 |
| 10 | P21246 | PTN | 0.8403 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKL STMI: SSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. DO_IUPRED2A: .........................DDDDDDDDDDDDDDDDD.......................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS_MOBI: ................................................................................ RICH_[K]: KpgaKKdtKdsrpK
120 140 160 AA: AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL STMI: DO_DISOPRED3: ........................................................................... DO_IUPRED2A: ........................................................................... DO_SPOTD: .........................................................................DD CONSENSUS: ........................................................................... CONSENSUS_MOBI: ...........................................................................