O95999 BCL10_HUMAN

Gene name: BCL10
Protein name: B-cell lymphoma/leukemia 10

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- embryo development GO:0009790
- homeostatic process GO:0042592
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IVF7 FMNL3 0.71646 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell morphogenesis GO:0000902
...
2 Q9NSA1 FGF21 0.69374 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
3 Q7Z3H0 ANKRD33 0.66867 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 Q96LX7 CCDC17 0.65747
5 Q6ZS72 PEAK3 0.65737 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular protein modification process GO:0006464
...
6 Q8N9I9 DTX3 0.65674 cellular protein modification process GO:0006464
signal transduction GO:0007165
7 Q8NBT3 TMEM145 0.64407 signal transduction GO:0007165
8 Q9H7D0 DOCK5 0.63594 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
9 P35212 GJA4 0.61786 anatomical structure development GO:0048856
cell junction organization GO:0034330
cell-cell signaling GO:0007267
...
10 Q13568 IRF5 0.61518 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKIT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD.DD...........................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDD...........................................DD.........D.............DDD................
DO_SPOTD:                DDDDDD..............................................................................................
CONSENSUS:               DDDDDDDDD...........................................................................................
CONSENSUS_MOBI:          DDDDDDDDD...........................................................................................

                                          120                 140                 160                 180                 200
AA:                      DEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGA
STMI:                                                                                                                        
DO_DISOPRED3:            ......................DDDDD..................................D....DDDDDDDDDDDDDDDDDDDDDD............
DO_IUPRED2A:             ...........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDD
DO_SPOTD:                ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ......................................................................................DDDDDDDDDDDDDD
RICH_[PT]:                                                                                                TenTifssTTlPrPgdPga
RICH_[N]:                                              NNlsrsNsdesN                                                          
RICH_[P]:                                                                                                            PrPgdPga
RICH_[S]:                                                 SrSnSdeSnfSeklraS                                                  
RICH_[T]:                                                                  TvmyhpegessTTpffsT             TenTifssTT         
RICH_[LP]:                                                                                                          LPrPgdPga
RICH_[NS]:                                             NNlSrSNSdeSNfSeklraS                                                  
RICH_fLPS_[P]:                                                                                                     tlPrPgdPga
RICH_MOBI_[L]:                                                                                                      Lprpgdpga
RICH_MOBI_[P]:                                                                                                       PrPgdPga
RICH_MOBI_[LP]:                                                                                                     LPrPgdPga
RICH_fLPS_MOBI_[P]:                                                                                                tlPrPgdPga

                                          220       
AA:                      PPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ
STMI:                                                     
DO_DISOPRED3:            ....D...DDDDDDDDDD....DDD.....DDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDD.DDDDD..D
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PT]:               P                                
RICH_[P]:                PPlPP                            
RICH_[EL]:                 LppdLqLEEEgtcanssEmfLpL        
RICH_[EP]:               PPlPPdlqlEEEgtcanssE             
RICH_[LP]:               PPLPPdLqL                        
RICH_fLPS_[P]:           PPlPP                            
RICH_MOBI_[L]:           ppLppdLqL                        
RICH_MOBI_[P]:           PPlPP                            
RICH_MOBI_[EL]:                LqLEEEgtcanssEmfLpL        
RICH_MOBI_[LP]:          PPLPPdLqL                        
RICH_fLPS_MOBI_[P]:      PPlPP