P01112 RASH_HUMAN
Gene name: HRAS
Protein name: GTPase HRas
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell death GO:0008219
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- protein targeting GO:0006605
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H0M5 | ZNF700 | 0.96904 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | P43250 | GRK6 | 0.75322 | cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 3 | Q9UHQ1 | NARF | 0.68599 | |
| 4 | P54687 | BCAT1 | 0.59842 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 5 | Q9NPF0 | CD320 | 0.55896 | cell population proliferation GO:0008283 immune system process GO:0002376 small molecule metabolic process GO:0044281 ... |
| 6 | Q17RS7 | GEN1 | 0.55346 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | P28799 | GRN | 0.54643 | |
| 8 | Q9BSK4 | FEM1A | 0.54595 | |
| 9 | Q9Y5W5 | WIF1 | 0.53651 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 10 | Q9Y2I2 | NTNG1 | 0.52748 |
20 40 60 80 100 AA: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQI STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ..................................................................D................................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS STMI: DO_DISOPRED3: .....................................................................DDDDDDDDDDDDDDDDD.DD DO_IUPRED2A: ...................................................................DDDDDD................ DO_SPOTD: .....................................................................DDDDDDDDDDDDDD.....D CONSENSUS: .....................................................................DDDDDDDDDDDDDD.....D CONSENSUS_MOBI: .......................................................................DDDDDDDDDDDDDDDDDD RICH_fLPS_MOBI_[C]: nppdesgpgCmsCkC