P01116 RASK_HUMAN
Gene name: KRAS
Protein name: GTPase KRas
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- homeostatic process GO:0042592
- immune system process GO:0002376
- nervous system process GO:0050877
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NRW1 | RAB6B | 0.9916 | protein transport GO:0015031 signal transduction GO:0007165 transport GO:0006810 ... |
| 2 | Q8TCF1 | ZFAND1 | 0.968 | protein transport GO:0015031 transport GO:0006810 |
| 3 | Q9NWL6 | ASNSD1 | 0.83874 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 4 | Q8N3J2 | METTL4 | 0.82843 | cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 DNA metabolic process GO:0006259 |
| 5 | Q5T601 | ADGRF1 | 0.82074 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 6 | Q8IY21 | DDX60 | 0.82034 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 |
| 7 | Q9NZQ7 | CD274 | 0.70711 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 8 | Q9Y6A9 | SPCS1 | 0.70711 | biological process involved in symbiotic interaction GO:0044403 cellular nitrogen compound metabolic process GO:0034641 protein maturation GO:0051604 ... |
| 9 | Q9H0A6 | RNF32 | 0.67982 | |
| 10 | P20774 | OGN | 0.66349 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
20 40 60 80 100 AA: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQI STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ..................................................................D................................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: KRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM STMI: DO_DISOPRED3: .....................................................................DDDDDDDDDDDDDDD..... DO_IUPRED2A: ......................................................................................... DO_SPOTD: .....................................................................DDDDDDDDDDDDDDDDDDDD CONSENSUS: .....................................................................DDDDDDDDDDDDDDD..... CONSENSUS_MOBI: ......................................................................................... RICH_[K]: KisKeeKtpgcvKiK RICH_[IK]: KIsKeeKtpgcvKIK