P01282 VIP_HUMAN
Gene name: VIP
Protein name: VIP peptides [Cleaved into: Intestinal peptide PHV-42
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell death GO:0008219
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- circulatory system process GO:0003013
- immune system process GO:0002376
- nervous system process GO:0050877
- nucleobase-containing compound catabolic process GO:0034655
- protein transport GO:0015031
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9Y243 | AKT3 | 0.89443 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell population proliferation GO:0008283 ... |
2 | Q96M32 | AK7 | 0.88492 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
3 | Q9GZL7 | WDR12 | 0.88492 |
cell cycle
GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
4 | Q0VD86 | INCA1 | 0.85166 |
cell cycle
GO:0007049 cell death GO:0008219 cell population proliferation GO:0008283 ... |
5 | P31749 | AKT1 | 0.8165 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
6 | A8MPS7 | YDJC | 0.81373 |
carbohydrate metabolic process
GO:0005975 |
7 | Q99965 | ADAM2 | 0.81373 |
cell adhesion
GO:0007155 membrane organization GO:0061024 nervous system process GO:0050877 ... |
8 | Q9Y487 | ATP6V0A2 | 0.81044 |
catabolic process
GO:0009056 homeostatic process GO:0042592 immune system process GO:0002376 ... |
9 | Q16342 | PDCD2 | 0.79436 |
anatomical structure development
GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
10 | O96024 | B3GALT4 | 0.79262 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
20 40 60 80 100
AA: MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAK
STMI: SSSSSSSSSSSSSSSSSSSS
DO_DISOPRED3: DDDDD...D...........................DDDD..DDD.DDDDDDDDDDDDDDDDD.....................................
DO_IUPRED2A: ........................................D............D.................DD...........................
DO_SPOTD: DDDDDDDDDDDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
CONSENSUS: ................DDDDDDDDDDDDDDDDDDDDDDDDDDD........DD...........................
CONSENSUS_MOBI: ................................................................................
120 140 160
AA: KYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
STMI:
DO_DISOPRED3: ..............DDDDDDDDDD.D..............................DDDDDDDDDDDDDD
DO_IUPRED2A: .............DDDDDD..DD..D..........................D.DDDDDDDDDDDDDDDD
DO_SPOTD: ........DDDDDDDDDDDDDDDDDDD..........................DDDDDDDDDDDDDDDDD
CONSENSUS: .............DDDDDDDDDDDDD............................DDDDDDDDDDDDDDDD
CONSENSUS_MOBI: ......................................................................
RICH_[E]: EgEspdfpEElE