List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- circulatory system process GO:0003013
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80   
AA:                      MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                     
DO_DISOPRED3:            DDDDDDDDDDDDDDDD....................................................................DDDDDDDDDDDDD
DO_IUPRED2A:             ..............................DDDDDDDDDDDDDD..............................D.DDDD...DDD..DDDDD....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                           ..DDDDDDDDD...................................D.DDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                      .....................................................................